Research use only ✓ COA TESAMORELIN

Growth Hormone & IGF Peptides

TESAMORELIN

Name: TESAMORELIN
Brand: Clean Peptide
SKU: tesamorelin
Price: 84.00 USD
Availability: InStock

CAS 218949-48-5 BATCH ACE-3023756

Tesamorelin is a synthetic analogue of growth hormone-releasing hormone (GHRH): the full 44-residue human sequence with a trans-3-hexenoyl group on the first tyrosine. This tesamorelin peptide, also listed as tesamorelin acetate, comes as 5 mg and 10 mg lyophilised vials, each size with its own ILS Laboratories certificate.

Mass

Clear

Quantity

−30% applied

Order within 17h 12m · ships TueCutoff 3:00 PM ET (12:00 PM PT)
Arrives Thu, Oct 29 – Tue, Nov 3Free standard shipping on orders over $100
Free shipment protectionLost, stolen, or damaged? We replace it, on us.
Overnight and 2-day optionsPick your speed at checkout
We acceptSecure 256-bit checkout

Verified test results

Every batch, independently verified.

Each batch is analyzed by an ISO/IEC 17025 accredited third-party laboratory before it ships. This is the released report for the size selected above, exactly as the lab signed it.

ILS LaboratoriesIndependent, ISO/IEC 17025 accredited

Certificate of analysis

99.40%

Purity by HPLC

Lot: ACE-3023756
Tested: Sep 9, 2026
Labeled: 5mg
Measured: 5.21mg

ISO 17025 accredited7× tested

Full QC panel

5 passed · 2 reported

Purity

HPLC · spec ≥ 95.0%

99.40%Pass

Net peptide content

5.21 mgReported

Identity

HPLC-RTM

ConfirmedPass

Fentanyl screen

Not DetectedPass

Heavy metals

ICP-MS

Not DetectedPass

Sterility

PCR

No GrowthPass

Endotoxin

USP <85>

0.101 EU/mLReported

Every size on record

Open any size’s signed certificate. Your order ships with the report for the size you buy.

TESAMORELIN 5mg

Selected

LOT ACE-3023756

99.40%

HPLC purity · meets spec

Labeled: 5mg
Measured: 5.21mg
Identity: Confirmed
Heavy metals: Not Detected
Sterility: No Growth
Endotoxin: 0.101 EU/mL
Tested: Sep 9, 2026

5 assays passed · ILS Laboratories, ISO/IEC 17025 accredited

TESAMORELIN 10mg

Selected

LOT ACE-1498675

99.74%

HPLC purity · meets spec

Labeled: 10mg
Measured: 10.51mg
Identity: Confirmed
Heavy metals: Not Detected
Sterility: No Growth
Endotoxin: NMT 0.05 EU/mL
Tested: Sep 10, 2026

5 assays passed · ILS Laboratories, ISO/IEC 17025 accredited

What is tesamorelin?

Tesamorelin (development code TH9507) was developed by Theratechnologies in Montreal. It keeps all 44 amino acids of human GHRH, the hypothalamic hormone that tells the pituitary to release growth hormone, and adds a six-carbon trans-3-hexenoyl group to the N-terminal tyrosine. Native GHRH is cut within minutes by the enzyme dipeptidyl peptidase-IV at exactly that end; the hexenoyl group makes tesamorelin resistant to it, and in plasma it breaks down more slowly than the native hormone.

Like GHRH, it acts on the GHRH receptor of pituitary somatotroph cells. The FDA label describes it as binding and stimulating human GHRH receptors in vitro with a potency similar to the endogenous hormone. That sets it apart from ipamorelin, which works through a different receptor (the ghrelin receptor), and from the shorter GHRH(1-29) analogues such as sermorelin and CJC-1295. See tesamorelin vs sermorelin and tesamorelin vs ipamorelin.

Tesamorelin identity

Names	Tesamorelin, tesamorelin acetate, TH9507, tesa; brand names Egrifta, Egrifta SV, Egrifta WR (Theratechnologies)
Sequence	`(trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2`
Parent peptide	Human GHRH(1-44), UniProt P01286
Modifications	trans-3-Hexenoyl group on Tyr1; C-terminal amide
Length	44 residues
Molecular formula	C₂₂₁H₃₆₆N₇₂O₆₇S (free base)
Molecular weight	5135.9 Da (free base, FDA label)
CAS number	218949-48-5 (tesamorelin); 901758-09-6 (tesamorelin acetate)
PubChem CID	16137828
Receptor	GHRH receptor (GHRHR) on pituitary somatotrophs
This product	5 mg and 10 mg, lyophilised powder

Sources: FDA substance registry (GSRS), the Egrifta SV label on DailyMed and PubChem.

Certificates for the current lots

Each size is filled from its own lot and analysed separately by ILS Laboratories in San Diego, which states ISO/IEC 17025 accreditation for activities within its published scope. Identity is confirmed by HPLC retention time against a tesamorelin reference standard, and the certificate reports net peptide content in milligrams. The same ILS full QC panel also reports endotoxin, sterility, heavy metals by ICP-MS and a fentanyl screen:

Size	Lot	Laboratory	Analysed	HPLC purity	Measured content	Identity
5mg	ACE-3023756	ILS Laboratories	9 Sep 2026	99.40%	5.21 mg	Confirmed
10mg	ACE-1498675	ILS Laboratories	10 Sep 2026	99.74%	10.51mg	Confirmed

Transcribed from the certificate issued for each size on sale today. The certificate names the material as Tesamorelin. Open the signed certificate for any size under Verified test results above. Every TESAMORELIN COA, lot by lot

Tesamorelin price

Price per vial and per milligram, read live from the store:

Size	List price	Price today	Per mg	Availability
5mg	~~$120.00~~	$84.00	$16.80	In stock
10mg	~~$107.55~~	$75.29	$7.53	In stock

Read from the store when this page loads, the same prices the TESAMORELIN product page shows.

Published research on tesamorelin

Tesamorelin is one of the few research peptides with a complete approval file behind it, so most of its literature is clinical. Each link goes to the PubMed record.

Non-clinical pharmacology (2007). Theratechnologies’ preclinical package described TH9507 as GHRH(1-44)-NH₂ with a trans-3-hexenoyl group on Tyr1, resistant to dipeptidyl aminopeptidase-IV and degraded more slowly than native GHRH in plasma. Repeated dosing raised GH and IGF-1 in pigs, rats and dogs. Non-clinical pharmacology and safety evaluation of TH9507, a human growth hormone-releasing factor analogue. Ferdinandi ES, et al. Basic & Clinical Pharmacology & Toxicology, 2007.
First phase 3 trial (2007). A 26-week, placebo-controlled trial in 412 adults with HIV and abdominal fat accumulation, with visceral adipose tissue measured by CT as the primary end point. It also tracked lipids, IGF-I and glucose measures. Metabolic effects of a growth hormone-releasing factor in patients with HIV. Falutz J, et al. NEJM, 2007.
Second phase 3 trial with safety extension (2010). 404 adults on antiretroviral therapy, six months placebo-controlled and then a six-month extension in which some participants were switched to placebo. Falutz J, et al. Journal of Acquired Immune Deficiency Syndromes, 2010.
Pooled phase 3 analysis (2010). The two trials together, 806 participants randomised 2:1, with 52-week data for those who continued. Falutz J, et al. Journal of Clinical Endocrinology & Metabolism, 2010.
GH pulsatility in healthy men (2011). A mechanistic study in 13 men used frequent overnight sampling and a glucose clamp. Two weeks of tesamorelin raised mean overnight GH, GH peak area and basal GH secretion, and raised IGF-I, with no significant change in insulin-stimulated glucose uptake. Effects of a growth hormone-releasing hormone analog on endogenous GH pulsatility and insulin sensitivity in healthy men. Stanley TL, et al. Journal of Clinical Endocrinology & Metabolism, 2011.
Liver fat in HIV (2019). A 12-month randomised trial in 61 people with HIV and a hepatic fat fraction of at least 5%, measured by proton MR spectroscopy (NCT02196831). Effects of tesamorelin on non-alcoholic fatty liver disease in HIV: a randomised, double-blind, multicentre trial. Stanley TL, et al. Lancet HIV, 2019.
Review (2012). A pharmacotherapy review of the approval data, which lists the lack of long-term safety data among its limitations. Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy. Spooner LM, et al. Annals of Pharmacotherapy, 2012.

In people, the label gives a mean elimination half-life of 8 minutes (Egrifta SV) and 11 minutes (Egrifta WR) after a single subcutaneous dose. In dogs the apparent half-life was 21–45 minutes.

Regulatory status

Tesamorelin is an FDA-approved drug. FDA first approved it on 10 November 2010 as Egrifta (Theratechnologies), and the current US labels, Egrifta SV and Egrifta WR, are indicated for the reduction of excess abdominal fat in adults with HIV and lipodystrophy. The label says it is not indicated for weight-loss management and that its long-term cardiovascular safety has not been established. Egrifta SV prescribing information, DailyMed. Clean Peptide’s tesamorelin is a laboratory reference material, not Theratechnologies’ product, and is not for human or veterinary use.

Related research

Tesamorelin vs sermorelin: GHRH(1-44) against GHRH(1-29).
Tesamorelin vs ipamorelin: the GHRH receptor against the ghrelin receptor.
CJC-1295 and IGF-1 LR3, with their own certificates.
All growth hormone and IGF research peptides.

Technical specification

What is on file, and how it is handled

Every figure below is transcribed from the paperwork for this compound.

Material

Compound: TESAMORELIN
Class: GHRH(1-44) analogue
Form: Lyophilised powder
Sizes: 5mg, 10mg
Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula: C221H366N72O67S
CAS: 218949-48-5
Mol. weight: 5135.9 Da
Residues: 44

Verification

Identity: Confirmed on the certificate of analysis
Purity: ≥ 99.4% by HPLC
Batch: ACE-3023756
Documentation: Per-batch certificate of analysis

Handling

Storage: Store at −20 °C, protected from light
Intended use: In-vitro laboratory research only

Compound data on PubChem

QuestionsTESAMORELIN: frequently asked

What is tesamorelin?+

Tesamorelin (TH9507) is a synthetic analogue of growth hormone-releasing hormone: all 44 residues of human GHRH with a trans-3-hexenoyl group on the N-terminal tyrosine, which makes it resistant to dipeptidyl peptidase-IV. It acts on the GHRH receptor of the pituitary.

Is tesamorelin FDA-approved?+

Yes. FDA approved it in November 2010 as Egrifta (Theratechnologies). The current labels, Egrifta SV and Egrifta WR, cover one indication: reduction of excess abdominal fat in adults with HIV and lipodystrophy. Clean Peptide’s tesamorelin is a laboratory reference material, not that product.

What is the tesamorelin molecular weight?+

5135.9 Da as the free base (C221H366N72O67S), according to the FDA label. The CAS number is 218949-48-5; the acetate salt is 901758-09-6.

What is tesamorelin acetate?+

The acetate salt of tesamorelin, the form in the approved Egrifta product, whose label gives the formula C221H366N72O67S·xC2H4O2 (x about 7). Its CAS number is 901758-09-6; the free base is 218949-48-5. Research catalogues often list tesamorelin under this name.

How is tesamorelin different from sermorelin?+

Both act on the GHRH receptor. Sermorelin is the first 29 residues of GHRH with a C-terminal amide; tesamorelin is the full 44-residue sequence with an added hexenoyl group that protects its N-terminus from DPP-IV.

Is tesamorelin the same as ipamorelin?+

No. Tesamorelin is a 44-residue GHRH analogue acting on the GHRH receptor. Ipamorelin is a 5-residue peptide acting on the ghrelin receptor (GHS-R1a), a separate pathway for growth hormone release.

What does the tesamorelin certificate show?+

Each size has its own ILS Laboratories certificate, listed on this page with lot number, test date, HPLC purity, net peptide content and identity by HPLC retention time against a reference standard.

Shop all products